HORDB

ID: hor006132
Uniprot ID: P21808
Protein name: Bombyxin E-1 B chain
Gene name: BBXE1
Organism: Bombyx mori (Silk moth)
Family: Insulin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Bombyx (genus), Bombycinae (subfamily), Bombycidae (family), Bombycoidea (superfamily), Obtectomera , Ditrysia , Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0008083 growth factor activity
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: QEANVAHHYCGRHLANTLADLCWDTSVE
Length: 28
Propeptide: MNRPVFLVLLLTGFLCIAAQEANVAHHYCGRHLANTLADLCWDTSVEKRSESSLASYSSRGWPWLPTPNFNKRAIKKRGVVDECCIQPCTLDVLATYC
Signal peptide: MNRPVFLVLLLTGFLCIAA
Modification: T1 Pyrrolidone carboxylic acid
Glycosylation: NA
Mutagenesis: NA

Function: PTTH is a brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects.
Mechanism: Silk worm has two kinds of PTTH: 4K-PTTH and 22K-PTTH; there are four forms of 4K-PTTH.
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006132_AF2.pdb

hor006132_ESM.pdb

Mass:	363625	Formula:	C134H201N41O44S2
Absent amino acids:	FIKMP	Common amino acids:	A
pI:	5.34	Basic residues:	4
Polar residues:	9	Hydrophobic residues:	10
Hydrophobicity:	-40.71	Boman Index:	-5155
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	76.79
Instability Index:	3308.57	Extinction Coefficient cystines:	7115
Absorbance 280nm:	263.52

PubMed ID: 9253178
Title: Structure and expression of bombyxin E1 gene: a novel family gene that encodes bombyxin-IV, an insect insulin-related neurosecretory peptide.
PubMed ID: 1515030
Title: Determination of disulfide bond arrangement in bombyxin-IV, an insulin superfamily peptide from the silkworm, Bombyx mori, by combination of thermolysin digestion of natural peptide and selective synthesis of disulfide bond isomers.